PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g35760.1.p
Common NameBRADI_4g35760, LOC100843103
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 865aa    MW: 92088.5 Da    PI: 5.8358
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g35760.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-21127182156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r eL+++l+L+ rqVk+WFqNrR+++k
  Bradi4g35760.1.p 127 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSRRLNLESRQVKFWFQNRRTQMK 182
                       688999***********************************************999 PP

2START161.94.9e-513355614205
                       HHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
             START   4 eeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                       ++a++elvk  ++++p+W  s     e +n+de+++ f++  +     + +ea r++g+ +  +a+lv +l+d + +W e+++    +a+t++
  Bradi4g35760.1.p 335 LAAMDELVKVTQVDDPLWLPSLdsgfETLNNDEYRRAFPRVLAhspagFVSEATREVGLAIVSSAELVDSLMDAA-RWAEMFPcvvaRASTTD 426
                       789*****************9999**************9966699999***************************.***************** PP

                       EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.......-TTSEE-EESSEEEEEEEECTCEEE CS
             START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe......sssvvRaellpSgiliepksnghsk 163
                        is g      g +qlm aelq+lsplvp R+++f+R+++q+ +g w++vdvS d    p         ++++ ++llpSg+++e++ ng+ k
  Bradi4g35760.1.p 427 IISGGmpgtrsGSIQLMHAELQVLSPLVPiREVTFLRFCKQHAEGLWAVVDVSADGVLRPDGgagngaAAGYMGCRLLPSGCVVEDMRNGYAK 519
                       *******************************************************99998877777889************************ PP

                       EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
             START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                       vtwv h+++++  +h l+r+l++sg+a ga++w+a lqrqc+
  Bradi4g35760.1.p 520 VTWVVHAEYDETAVHHLYRPLLRSGQALGARRWLASLQRQCQ 561
                       *****************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.09E-22109184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-23114184IPR009057Homeodomain-like
PROSITE profilePS5007118.301124184IPR001356Homeobox domain
SMARTSM003891.5E-19125188IPR001356Homeobox domain
CDDcd000861.03E-19127184No hitNo description
PfamPF000466.4E-19127182IPR001356Homeobox domain
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
PROSITE profilePS5084839.06323565IPR002913START domain
CDDcd088759.09E-107329561No hitNo description
SuperFamilySSF559611.18E-25330561No hitNo description
SMARTSM002341.1E-33332562IPR002913START domain
PfamPF018521.7E-42335561IPR002913START domain
SuperFamilySSF559611.1E-13640781No hitNo description
SuperFamilySSF559611.1E-13813853No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 865 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAG GGAGMHNNPR LLPSPPLPRP GGGGFGSSTG LSLGLQQTNM  60
SMESGGPLAG DANRMVGLMG SSGSGGDGDS LGRGREDEND SRSGSDNLDG ASGDELDPDN  120
SNPRKKKKRY HRHTPQQIQE LEAVFKECPH PDEKQRMELS RRLNLESRQV KFWFQNRRTQ  180
MKTQIERHEN ALLRQENDKL RAENMTIREA MRSPICGNCG GAAVLGEVSL EEQHLRIENS  240
RLKDELDRVC SLAGKFLGRP ISTITSGLEF GIGATNGFGA LGPLGGSSSS VLQSIPDLMG  300
GSSAAAMRLP AGISGLDDAE SAIAVDRGVL LELGLAAMDE LVKVTQVDDP LWLPSLDSGF  360
ETLNNDEYRR AFPRVLAHSP AGFVSEATRE VGLAIVSSAE LVDSLMDAAR WAEMFPCVVA  420
RASTTDIISG GMPGTRSGSI QLMHAELQVL SPLVPIREVT FLRFCKQHAE GLWAVVDVSA  480
DGVLRPDGGA GNGAAAGYMG CRLLPSGCVV EDMRNGYAKV TWVVHAEYDE TAVHHLYRPL  540
LRSGQALGAR RWLASLQRQC QYLAILRNNS LPSQDNQAIS PVGRRSMLKL AQRMADNFCA  600
GVCATAAQKW RRLDEWRVEG AMPGGGDQQQ HQAGGGDGDK EVRMMARHSV GAPGEPPGVV  660
LSATTSVRLP GTPPQRVFDY LRDEQRRGEW DILANGEAMQ EMDHIAKGQL HGNAVSLLRP  720
NATSGNQNNM LILQETCTDS SGSLVVYAPV DVQSMHIVMN GGDSAYVSLL PSGFAILPDG  780
HNTPPGAVVD PAGSSQQSQQ GSSESAAHGN NNTGSLVTVA FQILVNNLPT AKLTVESVDT  840
VSNLLSCTIQ KIKSALQASN NISP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123128RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578475.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLI1IS180.0I1IS18_BRADI; Uncharacterized protein
STRINGBRADI4G35760.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein